PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020916-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 350aa    MW: 39368.8 Da    PI: 8.4512
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020916-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.5e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  AHYPO_020916-RA 14 KGPWSPEEDAKLKAYIEKFGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding40.37.3e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd +++ +    G++ W+ Ia+ ++ gRt++++k++w++
  AHYPO_020916-RA  69 GGFTEEEDNIILSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.487962IPR017930Myb domain
SuperFamilySSF466891.23E-2711109IPR009057Homeodomain-like
SMARTSM007177.2E-131364IPR001005SANT/Myb domain
PfamPF002493.5E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-251569IPR009057Homeodomain-like
CDDcd001678.83E-91662No hitNo description
PROSITE profilePS5129422.6863117IPR017930Myb domain
SMARTSM007173.7E-1267115IPR001005SANT/Myb domain
PfamPF002491.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2470117IPR009057Homeodomain-like
CDDcd001672.44E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKAYIE KFGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FTEEEDNIIL SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
RKQQQQNGSN GSNDELPTLS SSALERLQLH LQLQTQHNSL SLFNNPTIWP KLHPLIQQKL  180
IQNNLNPLNP QIIQYPNSNN NNIINNNNNI SIFNQNSGIM GNNNNIIMNN INKEQVDQDQ  240
LENSSLNGSS SSSGLSSNLV NNGINNDKNN ENEMGNNNNF RVLKTEGYST SMQRVLSFQA  300
ELNELLGSDD QKIIGNVDFD GINGWWSNSV STCWDSSSML YNNNQDYDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-25141177108B-MYB
1h8a_C2e-241411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688500.11e-132PREDICTED: transcription factor RAX3
SwissprotQ9FKL21e-99MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A0K9QMI21e-150A0A0K9QMI2_SPIOL; Uncharacterized protein
STRINGPOPTR_0018s10390.11e-104(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.15e-79myb domain protein 36